PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000134.1_g00027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 400aa    MW: 44817.3 Da    PI: 5.0566
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000134.1_g00027.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.6e-51311581128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv +yL++++ gk++++ ++++e+d+yk+ePw+L +   +k+++ ewyfFs+ d+ky +g+r nrat +gyWk
  Itr_sc000134.1_g00027.1  31 LAPGFRFHPTDEELVRYYLRRRACGKPFRF-QAVSEIDVYKSEPWELAEysYLKTRDLEWYFFSPVDRKYGNGSRLNRATGKGYWK 115
                              579*************************99.88**************84346777888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v + k+++vg+kktLvf+ grap+g++t+Wvmheyrl
  Itr_sc000134.1_g00027.1 116 ATGKDRPVRH-KSQTVGMKKTLVFHCGRAPDGKRTNWVMHEYRL 158
                              **********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-6227181IPR003441NAC domain
PROSITE profilePS5100557.65831181IPR003441NAC domain
PfamPF023651.2E-2733158IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MMEQQPAQEG GALVVASPAP PKRTLAPPTS LAPGFRFHPT DEELVRYYLR RRACGKPFRF  60
QAVSEIDVYK SEPWELAEYS YLKTRDLEWY FFSPVDRKYG NGSRLNRATG KGYWKATGKD  120
RPVRHKSQTV GMKKTLVFHC GRAPDGKRTN WVMHEYRLTD NELVEAGVTQ DAFVLCRIFQ  180
KSALGPPNGD RYAPFVEEEW DDGKALVVPG GVAEDDVANG DDARVDGNDL DQGALCKAPE  240
SPVEPLSLSF VCKRERSEED PEPLSLAQSK RSKQDCPSSS HANGSEDSTT TSQDPPTMMM  300
TTNDSSPVLL EFPLLDPTEP RENQPTNAPT FDSSTLEKSV PPGYLKFISN LENEILNVSM  360
ERETLKIEVM RAQAMINILQ SRIDLLNKEN EDLRRVVRGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-523018316167NAC domain-containing protein 19
4dul_A4e-523018316167NAC domain-containing protein 19
1ut7_B4e-523018316167NO APICAL MERISTEM PROTEIN
1ut7_A4e-523018316167NO APICAL MERISTEM PROTEIN
1ut4_B4e-523018316167NO APICAL MERISTEM PROTEIN
1ut4_A4e-523018316167NO APICAL MERISTEM PROTEIN
3swp_D4e-523018319170NAC domain-containing protein 19
3swp_C4e-523018319170NAC domain-containing protein 19
3swp_B4e-523018319170NAC domain-containing protein 19
3swp_A4e-523018319170NAC domain-containing protein 19
3swm_D4e-523018319170NAC domain-containing protein 19
3swm_C4e-523018319170NAC domain-containing protein 19
3swm_B4e-523018319170NAC domain-containing protein 19
3swm_A4e-523018319170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016432498.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLQ8LRM10.0Q8LRM1_PETHY; Nam-like protein 4
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-114NAC domain containing protein 50